PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_009283-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family NF-YB
Protein Properties Length: 132aa    MW: 14121.9 Da    PI: 5.2454
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_009283-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB156.73.8e-4944129287
          NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvyl 87 
                    +eqdr+lPianv+rimk++lP nakisk+aket+qecvsefisfvt+easdkc++ekrkt+ngdd++wal+tlGf+dy+eplk  +
  NNU_009283-RA  44 KEQDRLLPIANVGRIMKQILPLNAKISKEAKETMQECVSEFISFVTGEASDKCHKEKRKTVNGDDICWALGTLGFDDYAEPLKSLI 129
                    89********************************************************************************9877 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.107.6E-4740129IPR009072Histone-fold
SuperFamilySSF471131.55E-3546129IPR009072Histone-fold
PfamPF008081.8E-2749113IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006158.8E-167795No hitNo description
PROSITE patternPS0068508096IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006158.8E-1696114No hitNo description
PRINTSPR006158.8E-16115132No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 132 aa     Download sequence    Send to blast
MVDNIGSRSP DWEGNNKYKS TAGGGASAIR GASASAAGDD GSIKEQDRLL PIANVGRIMK  60
QILPLNAKIS KEAKETMQEC VSEFISFVTG EASDKCHKEK RKTVNGDDIC WALGTLGFDD  120
YAEPLKSLIA TI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g91_B5e-4143126184Transcription factor HapC (Eurofung)
4g92_B5e-4143126184Transcription factor HapC (Eurofung)
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010259679.14e-90PREDICTED: nuclear transcription factor Y subunit B-5-like
SwissprotO822483e-53NFYB5_ARATH; Nuclear transcription factor Y subunit B-5
TrEMBLF6HPZ63e-61F6HPZ6_VITVI; Putative uncharacterized protein
STRINGVIT_07s0104g01640.t018e-61(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47810.12e-53nuclear factor Y, subunit B5